Total number of results for Lithobates catesbeiana are 34
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP01209 |
SIPNLPQRF
|
9 | Lithobates catesbeiana | FMRFamide related peptide | fGRP-related peptide 1 | 12600686#Kanetoh T, Sugikawa T, Sasaki I, Muneoka Y, Minakata H, Takabatake I, Fujimoto M#Identification of a novel frog RFamide and its effect on the latency of the tail-flick response of the newt#Comp Biochem Physiol C Toxicol Pharmacol 2003 Feb;134(2):259-66 | |
NP01787 |
SIPNLPQRF
|
9 | Lithobates catesbeiana | FMRFamide related peptide | fGRP-related peptide 1 | ||
NP01788 |
YLSGKTKVQSMANLPQRF
|
18 | Lithobates catesbeiana | FMRFamide related peptide | fGRP-related peptide 2 | ||
NP01789 |
AQYTNHFVHSLDTLPLRF
|
18 | Lithobates catesbeiana | FMRFamide related peptide | fGRP-related peptide 3 | ||
NP01790 |
SLKPAANLPLRF
|
12 | Lithobates catesbeiana | FMRFamide related peptide | Growth hormone-releasing peptide | 11796493#Koda A., Ukena K., Teranishi H., Ohta S., Yamamoto K., Kikuyama S., Tsutsui K.; #A novel amphibian hypothalamic neuropeptide: isolation, localization, and biological activity.; #Endocrinology 143:411-419(2002). | |
NP02182 |
QQTVGSMNEDPGAREIEQQNILQHPRHIRASSSAQLKPFQRIDGTSDQKAVIGAMLAKYLQTRKAGSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
|
110 | Lithobates catesbeiana | Gastrin/cholecystokinin | Cholecystokinin | ||
NP02183 |
RIDGTSDQKAVIGAMLAKYLQTRKAGSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDF
|
58 | Lithobates catesbeiana | Gastrin/cholecystokinin | Cholecystokinin-58 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
NP02184 |
GSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDF
|
33 | Lithobates catesbeiana | Gastrin/cholecystokinin | Cholecystokinin-33 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
NP02185 |
DYMGWMDF
|
8 | Lithobates catesbeiana | Gastrin/cholecystokinin | Cholecystokinin-8 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
NP02186 |
YMGWMDF
|
7 | Lithobates catesbeiana | Gastrin/cholecystokinin | Cholecystokinin-7 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
NP02347 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNSKRSGGIS
|
36 | Lithobates catesbeiana | Glucagon | Glucagon-36 | 3260236#Pollock H.G., Hamilton J.W., Rouse J.B., Ebner K.E., Rawitch A.B.#Isolation of peptide hormones from the pancreas of the bullfrog (Rana catesbeiana). Amino acid sequences of pancreatic polypeptide, oxyntomodulin, and two glucagon-like peptides.# J. Biol. Chem. 263:9746-9751(1988). | |
NP02348 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNS
|
29 | Lithobates catesbeiana | Glucagon | Glucagon | 3260236#Pollock H.G., Hamilton J.W., Rouse J.B., Ebner K.E., Rawitch A.B.#Isolation of peptide hormones from the pancreas of the bullfrog (Rana catesbeiana). Amino acid sequences of pancreatic polypeptide, oxyntomodulin, and two glucagon-like peptides.# J. Biol. Chem. 263:9746-9751(1988). | |
NP02349 |
HADGTFTSDMSSYLEEKAAKEFVDWLIKGRPK
|
32 | Lithobates catesbeiana | Glucagon | Glucagon-like peptide 1 | 3260236#Pollock H.G., Hamilton J.W., Rouse J.B., Ebner K.E., Rawitch A.B.#Isolation of peptide hormones from the pancreas of the bullfrog (Rana catesbeiana). Amino acid sequences of pancreatic polypeptide, oxyntomodulin, and two glucagon-like peptides.# J. Biol. Chem. 263:9746-9751(1988). | |
NP02350 |
HADGSFTSDFNKALDIKAAQEFLDWIINTPVKE
|
33 | Lithobates catesbeiana | Glucagon | Glucagon-like peptide 2 | 3260236#Pollock H.G., Hamilton J.W., Rouse J.B., Ebner K.E., Rawitch A.B.#Isolation of peptide hormones from the pancreas of the bullfrog (Rana catesbeiana). Amino acid sequences of pancreatic polypeptide, oxyntomodulin, and two glucagon-like peptides.# J. Biol. Chem. 263:9746-9751(1988). | |
NP03005 |
GLTFLSPADMQKIAERQSQNKLRHGNM
|
27 | Lithobates catesbeiana | Motilin | Ghrelin-27 | 11546772#Kaiya H., Kojima M., Hosoda H., Koda A., Yamamoto K., Kitajima Y., Matsumoto M., Minamitake Y., Kikuyama S., Kangawa K.; #Bullfrog ghrelin is modified by n-octanoic acid at its third threonine residue.; #J. Biol. Chem. 276:40441-40448(2001). | |
NP03006 |
GLTFLSPADMQKIAERQSQNKLRHGNMN
|
28 | Lithobates catesbeiana | Motilin | Ghrelin-28 | 11546772#Kaiya H., Kojima M., Hosoda H., Koda A., Yamamoto K., Kitajima Y., Matsumoto M., Minamitake Y., Kikuyama S., Kangawa K.; #Bullfrog ghrelin is modified by n-octanoic acid at its third threonine residue.; #J. Biol. Chem. 276:40441-40448(2001). | |
NP03638 |
GTSKGCFGLKLDRIGAMSGLGC
|
22 | Lithobates catesbeiana | Natriuretic peptide | C-type natriuretic peptide 2 | ||
NP03639 |
SMRRSSDCFGSRIDRIGAQSGMGCGRRF
|
28 | Lithobates catesbeiana | Natriuretic peptide | Atrial natriuretic factor (By similarity) | ||
NP03640 |
SSDCFGSRIDRIGAQSGMGCGRRF
|
24 | Lithobates catesbeiana | Natriuretic peptide | ANP-24 | 2972279#Sakata J., Kangawa K., Matsuo H.#Identification of new atrial natriuretic peptides in frog heart.# Biochem. Biophys. Res. Commun. 155:1338-1345(1988). | |
NP04762 |
QCWESNKCTDLSSEDGILECIKACKMDLSAESPVFPGNGHIQPLSENIRKYVMSHFRWNKFGRRNSTSNDNNNNNGGY
|
78 | Lithobates catesbeiana | POMC | NPP (By similarity) | ||
NP04763 |
YVMSHFRWNKF
|
11 | Lithobates catesbeiana | POMC | Melanotropin gamma (By similarity) | ||
NP04764 |
SYSMEHFRWGKPVGKKRRPIKVFPTDAEEESSESFPIEL
|
39 | Lithobates catesbeiana | POMC | Corticotropin (By similarity) | ||
NP04765 |
SYSMEHFRWGKPV
|
13 | Lithobates catesbeiana | POMC | Melanotropin alpha (By similarity) | ||
NP04766 |
PIKVFPTDAEEESSESFPIEL
|
21 | Lithobates catesbeiana | POMC | Corticotropin-like intermediary peptide (By similarity) | ||
NP04767 |
ELSLEFDYPDTNSEEELDNGELLEGPVKKGRKYKMHHFRWEGPPKDKRYGGFMTPERSQTPLMTLFKNAIIKNAHKKGQ
|
79 | Lithobates catesbeiana | POMC | Lipotropin beta (By similarity) | ||
NP04768 |
ELSLEFDYPDTNSEEELDNGELLEGPVKKGRKYKMHHFRWEGPPKD
|
46 | Lithobates catesbeiana | POMC | Lipotropin gamma (By similarity) | ||
NP04769 |
GRKYKMHHFRWEGPPKD
|
17 | Lithobates catesbeiana | POMC | Melanotropin beta (By similarity) | ||
NP04770 |
YGGFMTPERSQTPLMTLFKNAIIKNAHKKGQ
|
31 | Lithobates catesbeiana | POMC | Beta-endorphin (By similarity) | ||
NP04771 |
YGGFM
|
5 | Lithobates catesbeiana | POMC | Met-enkephalin (By similarity) | ||
NP05450 |
FPQMSLSNLFTNAVIRAQHLHQMVADTYRDYERTYIPEDQRFSNKHSYSVYCYSETIPAPTDKDNTHQKSDIDLLRFSLTLLQSWMTPIQIVNRVFGNNQVFGNIDRVYDRLRDLDEGLHILIRELDDGNVRNYGVLTFTYDKFDVNLRSEEGRAKNYGLLSCFKKDMHKVETYLKVMKCRRFVESNCTF
|
190 | Lithobates catesbeiana | Somatotropin/prolactin | Somatotropin | 1859828#Kobayashi T., Yasuda A., Yamaguchi K., Kawauchi H., Kikuyama S.#The complete amino acid sequence of growth hormone of the bullfrog (Rana catesbeiana).# Biochim. Biophys. Acta 1078:383-387(1991). | |
NP05690 |
KPSPDRFYGLM
|
11 | Lithobates catesbeiana | Tachykinin | Ranatachykinin-A | 2043143#Kozawa H., Hino J., Minamino N., Kangawa K., Matsuo H.; #Isolation of four novel tachykinins from frog (Rana catesbeiana) brain and intestine.; #Biochem. Biophys. Res. Commun. 177:588-595(1991).$8210506#Kangawa K., Kozawa H., Hino J., Minamino N., Matsuo H.; #"Four novel tachykinins in frog (Rana catesbeiana) brain and intestine."; #Regul. Pept. 46:81-88(1993). | |
NP05691 |
YKSDSFYGLM
|
10 | Lithobates catesbeiana | Tachykinin | Ranatachykinin-B | 2043143#Kozawa H., Hino J., Minamino N., Kangawa K., Matsuo H.; #Isolation of four novel tachykinins from frog (Rana catesbeiana) brain and intestine.; #Biochem. Biophys. Res. Commun. 177:588-595(1991).$8210506#Kangawa K., Kozawa H., Hino J., Minamino N., Matsuo H.; #Four novel tachykinins in frog (Rana catesbeiana) brain and intestine.; #Regul. Pept. 46:81-88(1993). | |
NP05692 |
HNPASFIGLM
|
10 | Lithobates catesbeiana | Tachykinin | Ranatachykinin C | 2043143#Kozawa H., Hino J., Minamino N., Kangawa K., Matsuo H.; #Isolation of four novel tachykinins from frog (Rana catesbeiana) brain and intestine.; #Biochem. Biophys. Res. Commun. 177:588-595(1991).$8210506#Kangawa K., Kozawa H., Hino J., Minamino N., Matsuo H.; #Four novel tachykinins in frog (Rana catesbeiana) brain and intestine.; #Regul. Pept. 46:81-88(1993). | |
NP05693 |
KPNPERFYAPM
|
11 | Lithobates catesbeiana | Tachykinin | Ranatachykinin-D | 2043143#Kozawa H., Hino J., Minamino N., Kangawa K., Matsuo H.; #Isolation of four novel tachykinins from frog (Rana catesbeiana) brain and intestine.; #Biochem. Biophys. Res. Commun. 177:588-595(1991).$8210506#Kangawa K., Kozawa H., Hino J., Minamino N., Matsuo H.; #"Four novel tachykinins in frog (Rana catesbeiana) brain and intestine."; #Regul. Pept. 46:81-88(1993). |